Recombinant Human TGFA

Species :	Human
Source :	E.coli
Tag :	Non
Form :	Lyophilized from a 0.2 μm filtered solution in PBS, with 0.02% Tween-20, pH 7.0.
Molecular Mass :	Approximately 6 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.
AASequence :	MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Endotoxin :	Less than 0.1 EU/µg of rHuTGF-α as determined by LAL method.
Purity :	>95% by SDS-PAGE analyses.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. - 12 months from date of receipt, -20 to -70 °C as supplied. - 1 month, 2 to 8 °C under sterile conditions after reconstitution. - 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Gene Name	TGFA transforming growth factor, alpha [ Homo sapiens ]
Official Symbol	TGFA
Synonyms	TGFA; transforming growth factor, alpha; protransforming growth factor alpha; TGF-alpha; TFGA;
Gene ID	7039
mRNA Refseq	NM_001099691
Protein Refseq	NP_001093161
MIM	190170
UniProt ID	P01135