Recombinant Human TGFA
Cat.No. : | TGFA-29704TH |
Product Overview : | Human TGF alpha. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Tissue specificity : | Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. |
Form : | Liquid |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | Recombinant Human TGF-a is a 5.5 kDa protein containing 50 amino acid residues:VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHA DLLA |
Sequence Similarities : | Contains 1 EGF-like domain. |
Gene Name | TGFA transforming growth factor, alpha [ Homo sapiens ] |
Official Symbol | TGFA |
Synonyms | TGFA; transforming growth factor, alpha; protransforming growth factor alpha; |
Gene ID | 7039 |
mRNA Refseq | NM_001099691 |
Protein Refseq | NP_001093161 |
MIM | 190170 |
Uniprot ID | P01135 |
Chromosome Location | 2p13 |
Pathway | Direct p53 effectors, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; |
Function | MAP kinase kinase activity; epidermal growth factor receptor binding; glycoprotein binding; growth factor activity; protein binding; |
◆ Recombinant Proteins | ||
TGFA-1538S | Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged | +Inquiry |
TGFA-655R | Recombinant Rat TGFA protein, His-KSI-tagged | +Inquiry |
TGFA-0738H | Recombinant Human TGFA protein, His-tagged | +Inquiry |
TGFA-3208H | Recombinant Human TGFA, GST-tagged | +Inquiry |
TGFA-828S | Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged | +Inquiry |
◆ Native Proteins | ||
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFA-1121HCL | Recombinant Human TGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFA Products
Required fields are marked with *
My Review for All TGFA Products
Required fields are marked with *