Recombinant Human TGFA

• Cat.No.: TGFA-29704TH
• Product Overview: Human TGF alpha.

Specification

• Description: This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Source: E. coli
• Tissue specificity: Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
• Form: Liquid
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: Recombinant Human TGF-a is a 5.5 kDa protein containing 50 amino acid residues:VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHA DLLA
• Sequence Similarities: Contains 1 EGF-like domain.
• Tag: Non

Gene Information

• Gene Name: TGFA transforming growth factor, alpha [ Homo sapiens ]
• Official Symbol: TGFA
• Synonyms: TGFA; transforming growth factor, alpha; protransforming growth factor alpha
• Gene ID: 7039
• mRNA Refseq: NM_001099691
• Protein Refseq: NP_001093161
• MIM: 190170
• Uniprot ID: P01135
• Chromosome Location: 2p13
• Pathway: Direct p53 effectors, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem
• Function: MAP kinase kinase activity; epidermal growth factor receptor binding; glycoprotein binding; growth factor activity; protein binding

Reviews

05/03/2020

Swift and accurate service, essential for research success.

04/14/2020

Invaluable support for insights, a research cornerstone.

12/21/2018

Trustworthy results, supports research consistency.

Q&As

How does TGFA contribute to cell growth and proliferation?

It stimulates cell proliferation and survival, playing a key role in tissue development.

How do genetic variations in TGFA affect tissue repair?

Genetic mutations in TGFA can lead to impaired wound healing and tissue regeneration.

What is the impact of altered TGFA activity on cancer development?

Altered TGFA activity is linked with cancer progression, as it can stimulate uncontrolled cell growth.

What is the primary role of TGFA in cell signaling?

TGFA, a growth factor, is vital for activating signaling pathways that control cell growth and differentiation.

What potential therapeutic applications arise from targeting TGFA in regenerative medicine and oncology?

Targeting TGFA offers potential for treating wounds and cancer by modulating growth factor signaling.

How does TGFA interact with other growth factors and receptors?

TGFA interacts with epidermal growth factor receptors, influencing various cellular processes.

What role does TGFA play in wound healing?

TGFA is important in wound healing, promoting the regeneration of skin and other tissues.