Recombinant Human TGFBR1 protein, His&Myc-tagged
Cat.No. : | TGFBR1-4633H |
Product Overview : | Recombinant Human TGFBR1 protein(P36897)(34-126aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 34-126aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL |
Gene Name | TGFBR1 transforming growth factor, beta receptor 1 [ Homo sapiens ] |
Official Symbol | TGFBR1 |
Synonyms | TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1; |
Gene ID | 7046 |
mRNA Refseq | NM_001130916 |
Protein Refseq | NP_001124388 |
MIM | 190181 |
UniProt ID | P36897 |
◆ Recombinant Proteins | ||
TGFBR1-1293H | Recombinant Human TGFBR1 Protein (T200-M503), Tag Free | +Inquiry |
TGFBR1-4633H | Recombinant Human TGFBR1 protein, His&Myc-tagged | +Inquiry |
Tgfbr1-439M | Active Recombinant Mouse Tgfbr1, Fc Chimera | +Inquiry |
TGFBR1-1292H | Recombinant Human TGFBR1 Protein (T200-M503), His tagged | +Inquiry |
TGFBR1-6434H | Recombinant Human TGFBR1 Protein (Leu34-Glu125), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR1-001HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
TGFBR1-2482HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFBR1 Products
Required fields are marked with *
My Review for All TGFBR1 Products
Required fields are marked with *
0
Inquiry Basket