Recombinant Human TGFBR1 protein, His&Myc-tagged
| Cat.No. : | TGFBR1-4633H |
| Product Overview : | Recombinant Human TGFBR1 protein(P36897)(34-126aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 34-126aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.6 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL |
| Gene Name | TGFBR1 transforming growth factor, beta receptor 1 [ Homo sapiens ] |
| Official Symbol | TGFBR1 |
| Synonyms | TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1; |
| Gene ID | 7046 |
| mRNA Refseq | NM_001130916 |
| Protein Refseq | NP_001124388 |
| MIM | 190181 |
| UniProt ID | P36897 |
| ◆ Recombinant Proteins | ||
| RFL34739HF | Recombinant Full Length Human Tgf-Beta Receptor Type-1(Tgfbr1) Protein, His-Tagged | +Inquiry |
| TGFBR1-1543H | Recombinant Human TGFBR1, Unactive, GST-tagged | +Inquiry |
| TGFBR1-02H | Active Recombinant Human TGFBR1 Protein (27-126aa), C-hIgG-His tagged | +Inquiry |
| Tgfbr1-1777M | Active Recombinant Mouse Tgfbr1 Protein, Fc-tagged | +Inquiry |
| TGFBR1-31137TH | Recombinant Human TGFBR1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFBR1-2482HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
| TGFBR1-001HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFBR1 Products
Required fields are marked with *
My Review for All TGFBR1 Products
Required fields are marked with *
