Recombinant Human TGM2 protein, His-tagged

Cat.No. : TGM2-903H
Product Overview : Recombinant Human TGM2 protein(NP_004604)(1-349 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-349 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Gene Name TGM2 transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) [ Homo sapiens ]
Official Symbol TGM2
Synonyms TGM2; transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase); protein-glutamine gamma-glutamyltransferase 2; TGC; TG(C); TGase C; TGase H; TGase-2; TGase-H; C polypeptide; transglutaminase C; transglutaminase H; transglutaminase-2; tissue transglutaminase; protein-glutamine-gamma-glutamyltransferase; TG2; GNAH; G-ALPHA-h;
Gene ID 7052
mRNA Refseq NM_004613
Protein Refseq NP_004604
MIM 190196
UniProt ID P21980

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGM2 Products

Required fields are marked with *

My Review for All TGM2 Products

Required fields are marked with *

0
cart-icon