Recombinant Human TGM2 protein, His-tagged
Cat.No. : | TGM2-903H |
Product Overview : | Recombinant Human TGM2 protein(NP_004604)(1-349 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-349 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Gene Name | TGM2 transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) [ Homo sapiens ] |
Official Symbol | TGM2 |
Synonyms | TGM2; transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase); protein-glutamine gamma-glutamyltransferase 2; TGC; TG(C); TGase C; TGase H; TGase-2; TGase-H; C polypeptide; transglutaminase C; transglutaminase H; transglutaminase-2; tissue transglutaminase; protein-glutamine-gamma-glutamyltransferase; TG2; GNAH; G-ALPHA-h; |
Gene ID | 7052 |
mRNA Refseq | NM_004613 |
Protein Refseq | NP_004604 |
MIM | 190196 |
UniProt ID | P21980 |
◆ Recombinant Proteins | ||
TGM2-903H | Recombinant Human TGM2 protein, His-tagged | +Inquiry |
TGM2-01H | Recombinant Human TGM2 protein, His-tagged | +Inquiry |
TGM2-922H | Recombinant Human TGM2 protein, His-tagged | +Inquiry |
TGM2-02H | Recombinant Human TGM2 protein, His-tagged | +Inquiry |
Tgm2-6396M | Recombinant Mouse Tgm2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGM2-686HCL | Recombinant Human TGM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGM2 Products
Required fields are marked with *
My Review for All TGM2 Products
Required fields are marked with *