Recombinant Human THAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : THAP1-3251H
Product Overview : THAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060575) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Molecular Mass : 24.9 kDa
AA Sequence : MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name THAP1 THAP domain containing 1 [ Homo sapiens (human) ]
Official Symbol THAP1
Synonyms THAP1; THAP domain containing, apoptosis associated protein 1; dystonia 6, torsion (autosomal dominant), DYT6; 4833431A01Rik; FLJ10477;
Gene ID 55145
mRNA Refseq NM_018105
Protein Refseq NP_060575
MIM 609520
UniProt ID Q9NVV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All THAP1 Products

Required fields are marked with *

My Review for All THAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon