Recombinant Human THAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | THAP1-3251H |
| Product Overview : | THAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060575) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Molecular Mass : | 24.9 kDa |
| AA Sequence : | MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | THAP1 THAP domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | THAP1 |
| Synonyms | THAP1; THAP domain containing, apoptosis associated protein 1; dystonia 6, torsion (autosomal dominant), DYT6; 4833431A01Rik; FLJ10477; |
| Gene ID | 55145 |
| mRNA Refseq | NM_018105 |
| Protein Refseq | NP_060575 |
| MIM | 609520 |
| UniProt ID | Q9NVV9 |
| ◆ Recombinant Proteins | ||
| THAP1-16729M | Recombinant Mouse THAP1 Protein | +Inquiry |
| THAP1-4277Z | Recombinant Zebrafish THAP1 | +Inquiry |
| THAP1-4692R | Recombinant Rhesus monkey THAP1 Protein, His-tagged | +Inquiry |
| THAP1-5704R | Recombinant Rat THAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| THAP1-5594H | Recombinant Human THAP Domain Containing, Apoptosis Associated Protein 1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| THAP1-1107HCL | Recombinant Human THAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THAP1 Products
Required fields are marked with *
My Review for All THAP1 Products
Required fields are marked with *




