Recombinant Human THBS1 Protein, His-tagged
Cat.No. : | THBS1-355H |
Product Overview : | Recombinant Human THBS1 fused with His tag at the C-terminus was produced in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Asn19-Pro1170 |
Description : | Thrombospondin-1 (TSP-1) is a 150-180kDa calcium-sensitive protein that is secreted as a disulfide-linked homotrimer. TSP-1 regulates a wide range of cellular functions including their interactions with other cells and with the extracellular matrix (ECM). TSP-1 contains an N-terminal Laminin G-like globular domain, an extended central region with one vWFC domain, 3 TSP type 1domains, 2 EGF-like domains, and 8 TSP type3 domains, and a globular TSP C-terminal domain. Distinct regions of TSP-1 have been associated with binding to particular ECM or cellular molecules. TSP-1 counteracts the angiogenic, hypotensive, and antithrombotic effects of nitric oxide (NO). It binds and neutralizes VEGF, blocks VEGF R2 signaling on vascular endothelial cells(EC), and destabilizes adhesive contacts between EC. TSP-1 also plays an important role in wound repair and tissue fibrosis by binding latent TGF-beta and inducing release of the active cytokine from the latency associated peptide (LAP). |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
AA sequence : | NRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVR AEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALL ATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQ NVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELS SMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQN SVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDS LNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKP CEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTEN QICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHN GEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGH YSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDG IGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACA ADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDID EDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVPNPDQKDSDGDGRGD ACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCD PGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGY SGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRV VMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDPGGGGSHHHHHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | THBS1 thrombospondin 1 [ Homo sapiens ] |
Official Symbol | THBS1 |
Synonyms | THBS1; thrombospondin 1; thrombospondin-1; THBS; THBS 1; thrombospondin 1p180; TSP; TSP 1; TSP1; thrombospondin-1p180; TSP-1; THBS-1; |
Gene ID | 7057 |
mRNA Refseq | NM_003246 |
Protein Refseq | NP_003237 |
MIM | 188060 |
UniProt ID | P07996 |
◆ Recombinant Proteins | ||
THBS1-51H | Recombinant Human THBS1 Protein | +Inquiry |
Thbs1-6407M | Recombinant Mouse Thbs1 Protein, Myc/DDK-tagged | +Inquiry |
THBS1-3321H | Recombinant Human THBS1 protein, His-tagged | +Inquiry |
Thbs1-2662R | Recombinant Rat Thbs1 protein, His-tagged | +Inquiry |
THBS1-08H | Active Recombinant Human THBS1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
THBS1-1101HCL | Recombinant Human THBS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THBS1 Products
Required fields are marked with *
My Review for All THBS1 Products
Required fields are marked with *
0
Inquiry Basket