Recombinant Human THBS1 protein, His-tagged
| Cat.No. : | THBS1-3321H |
| Product Overview : | Recombinant Human THBS1 protein(25-250 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-250 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | THBS1 thrombospondin 1 [ Homo sapiens ] |
| Official Symbol | THBS1 |
| Synonyms | THBS1; thrombospondin 1; thrombospondin-1; THBS; THBS 1; thrombospondin 1p180; TSP; TSP 1; TSP1; thrombospondin-1p180; TSP-1; THBS-1; |
| Gene ID | 7057 |
| mRNA Refseq | NM_003246 |
| Protein Refseq | NP_003237 |
| MIM | 188060 |
| UniProt ID | P07996 |
| ◆ Recombinant Proteins | ||
| Thbs1-6407M | Recombinant Mouse Thbs1 Protein, Myc/DDK-tagged | +Inquiry |
| Thbs1-2664R | Recombinant Rat Thbs1 protein, His-tagged | +Inquiry |
| THBS1-894H | Recombinant Human THBS1 Protein, MYC/DDK-tagged | +Inquiry |
| Thbs1-2659M | Recombinant Mouse Thbs1 protein, His-tagged | +Inquiry |
| THBS1-51H | Recombinant Human THBS1 Protein | +Inquiry |
| ◆ Native Proteins | ||
| THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
| THBS1-31515TH | Native Human THBS1 | +Inquiry |
| THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
| THBS1-31514TH | Native Human THBS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| THBS1-1101HCL | Recombinant Human THBS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THBS1 Products
Required fields are marked with *
My Review for All THBS1 Products
Required fields are marked with *
