Recombinant Human THG1L protein, GST-tagged
| Cat.No. : | THG1L-3219H |
| Product Overview : | Recombinant Human THG1L protein(1-269 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-269 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | THG1L tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | THG1L |
| Synonyms | THG1L; tRNA-histidine guanylyltransferase 1-like (S. cerevisiae); probable tRNA(His) guanylyltransferase; FLJ11601; FLJ20546; ICF45; interphase cytoplasmic foci protein 45; |
| Gene ID | 54974 |
| mRNA Refseq | NM_017872 |
| Protein Refseq | NP_060342 |
| UniProt ID | Q9NWX6 |
| ◆ Recombinant Proteins | ||
| THG1L-1831Z | Recombinant Zebrafish THG1L | +Inquiry |
| THG1L-2325C | Recombinant Chicken THG1L | +Inquiry |
| THG1L-5709R | Recombinant Rat THG1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| THG1L-3219H | Recombinant Human THG1L protein, GST-tagged | +Inquiry |
| Thg1l-6412M | Recombinant Mouse Thg1l Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| THG1L-1096HCL | Recombinant Human THG1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THG1L Products
Required fields are marked with *
My Review for All THG1L Products
Required fields are marked with *
