Recombinant Human THG1L protein, GST-tagged
Cat.No. : | THG1L-3219H |
Product Overview : | Recombinant Human THG1L protein(1-269 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-269 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | THG1L tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | THG1L |
Synonyms | THG1L; tRNA-histidine guanylyltransferase 1-like (S. cerevisiae); probable tRNA(His) guanylyltransferase; FLJ11601; FLJ20546; ICF45; interphase cytoplasmic foci protein 45; |
Gene ID | 54974 |
mRNA Refseq | NM_017872 |
Protein Refseq | NP_060342 |
UniProt ID | Q9NWX6 |
◆ Recombinant Proteins | ||
THG1L-4699R | Recombinant Rhesus monkey THG1L Protein, His-tagged | +Inquiry |
THG1L-16745M | Recombinant Mouse THG1L Protein | +Inquiry |
THG1L-5807H | Recombinant Human THG1L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
THG1L-2325C | Recombinant Chicken THG1L | +Inquiry |
THG1L-1831Z | Recombinant Zebrafish THG1L | +Inquiry |
◆ Cell & Tissue Lysates | ||
THG1L-1096HCL | Recombinant Human THG1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THG1L Products
Required fields are marked with *
My Review for All THG1L Products
Required fields are marked with *