Recombinant Human THOC5 protein, His-tagged

Cat.No. : THOC5-3354H
Product Overview : Recombinant Human THOC5 protein(354-683 aa), fused to His tag, was expressed in E. coli.
Availability November 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 354-683 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : CKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTIAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPIFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name THOC5 THO complex 5 [ Homo sapiens ]
Official Symbol THOC5
Synonyms THOC5; THO complex 5; C22orf19, chromosome 22 open reading frame 19; THO complex subunit 5 homolog; Fmip; fSAP79; functional spliceosome associated protein 79; KIAA0983; PK1.3; PP39.2; hTREX90; placental protein 39.2; Fms-interacting protein; NF2/meningioma region protein pK1.3; functional spliceosome-associated protein 79; C22orf19;
Gene ID 8563
mRNA Refseq NM_001002877
Protein Refseq NP_001002877
MIM 612733
UniProt ID Q13769

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All THOC5 Products

Required fields are marked with *

My Review for All THOC5 Products

Required fields are marked with *

0
cart-icon
0
compare icon