Recombinant Human THOC5 protein, His-tagged
Cat.No. : | THOC5-3354H |
Product Overview : | Recombinant Human THOC5 protein(354-683 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 354-683 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTIAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPIFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | THOC5 THO complex 5 [ Homo sapiens ] |
Official Symbol | THOC5 |
Synonyms | THOC5; THO complex 5; C22orf19, chromosome 22 open reading frame 19; THO complex subunit 5 homolog; Fmip; fSAP79; functional spliceosome associated protein 79; KIAA0983; PK1.3; PP39.2; hTREX90; placental protein 39.2; Fms-interacting protein; NF2/meningioma region protein pK1.3; functional spliceosome-associated protein 79; C22orf19; |
Gene ID | 8563 |
mRNA Refseq | NM_001002877 |
Protein Refseq | NP_001002877 |
MIM | 612733 |
UniProt ID | Q13769 |
◆ Recombinant Proteins | ||
THOC5-16751M | Recombinant Mouse THOC5 Protein | +Inquiry |
THOC5-1344C | Recombinant Chicken THOC5 | +Inquiry |
THOC5-6054R | Recombinant Rat THOC5 Protein | +Inquiry |
THOC5-29516TH | Recombinant Human THOC5 | +Inquiry |
THOC5-2966H | Recombinant Human THO Complex 5, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
THOC5-1776HCL | Recombinant Human THOC5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THOC5 Products
Required fields are marked with *
My Review for All THOC5 Products
Required fields are marked with *
0
Inquiry Basket