Recombinant Human THOC7 protein, GST-tagged
| Cat.No. : | THOC7-30155H |
| Product Overview : | Recombinant Human THOC7 (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Pro204 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | THOC7 THO complex 7 homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | THOC7 |
| Synonyms | THOC7; THO complex 7 homolog (Drosophila); THO complex subunit 7 homolog; FLJ23445; fSAP24; functional spliceosome associated protein 24; Ngg1 interacting factor 3 like 1 binding protein 1; NIF3L1BP1; hTREX30; NIF3L1-binding protein 1; functional spliceosome-associated protein 24; ngg1-interacting factor 3-like protein 1-binding protein 1; |
| Gene ID | 80145 |
| mRNA Refseq | NM_025075 |
| Protein Refseq | NP_079351 |
| MIM | 611965 |
| UniProt ID | Q6I9Y2 |
| ◆ Recombinant Proteins | ||
| THOC7-9196M | Recombinant Mouse THOC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| THOC7-4722H | Recombinant Human THOC7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| THOC7-3706C | Recombinant Chicken THOC7 | +Inquiry |
| THOC7-881Z | Recombinant Zebrafish THOC7 | +Inquiry |
| THOC7-30155H | Recombinant Human THOC7 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| THOC7-1091HCL | Recombinant Human THOC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THOC7 Products
Required fields are marked with *
My Review for All THOC7 Products
Required fields are marked with *



