Recombinant Human THPO protein(22-353 aa), N-MBP & C-His-tagged
| Cat.No. : | THPO-2754H |
| Product Overview : | Recombinant Human THPO protein(P40225)(22-353 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 22-353 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
| Gene Name | THPO thrombopoietin [ Homo sapiens (human) ] |
| Official Symbol | THPO |
| Synonyms | THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs |
| Gene ID | 7066 |
| mRNA Refseq | NM_000460 |
| Protein Refseq | NP_000451 |
| MIM | 600044 |
| UniProt ID | P40225 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THPO Products
Required fields are marked with *
My Review for All THPO Products
Required fields are marked with *
