Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | THYN1-2088H |
Product Overview : | THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_001032382) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | THYN1 thymocyte nuclear protein 1 [ Homo sapiens (human) ] |
Official Symbol | THYN1 |
Synonyms | THYN1; thymocyte nuclear protein 1; THY28; thymocyte protein thy28; MY105; MDS012; HSPC144; THY28KD; MGC12187; |
Gene ID | 29087 |
mRNA Refseq | NM_001037305 |
Protein Refseq | NP_001032382 |
MIM | 613739 |
UniProt ID | Q9P016 |
◆ Recombinant Proteins | ||
THYN1-9204M | Recombinant Mouse THYN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
THYN1-646H | Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Thyn1-6422M | Recombinant Mouse Thyn1 Protein, Myc/DDK-tagged | +Inquiry |
THYN1-5860C | Recombinant Chicken THYN1 | +Inquiry |
THYN1-2088H | Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
THYN1-1082HCL | Recombinant Human THYN1 293 Cell Lysate | +Inquiry |
THYN1-1081HCL | Recombinant Human THYN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THYN1 Products
Required fields are marked with *
My Review for All THYN1 Products
Required fields are marked with *
0
Inquiry Basket