Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : THYN1-2088H
Product Overview : THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_001032382) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Mass : 25.5 kDa
AA Sequence : MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name THYN1 thymocyte nuclear protein 1 [ Homo sapiens (human) ]
Official Symbol THYN1
Synonyms THYN1; thymocyte nuclear protein 1; THY28; thymocyte protein thy28; MY105; MDS012; HSPC144; THY28KD; MGC12187;
Gene ID 29087
mRNA Refseq NM_001037305
Protein Refseq NP_001032382
MIM 613739
UniProt ID Q9P016

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All THYN1 Products

Required fields are marked with *

My Review for All THYN1 Products

Required fields are marked with *

0
cart-icon