Recombinant Human TIMM10B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TIMM10B-6582H
Product Overview : FXC1 MS Standard C13 and N15-labeled recombinant protein (NP_036324) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.
Molecular Mass : 11.6 kDa
AA Sequence : MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPSVAAEQPGVSPSGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TIMM10B translocase of inner mitochondrial membrane 10B [ Homo sapiens (human) ]
Official Symbol TIMM10B
Synonyms TIMM10B; translocase of inner mitochondrial membrane 10B; FXC1; Tim9b; TIM10B; mitochondrial import inner membrane translocase subunit Tim10 B; fracture callus 1 homolog; fracture callus protein 1; mitochondrial import inner membrane translocase subunit Tim9 B; translocase of inner mitochondrial membrane 10 homolog B
Gene ID 26515
mRNA Refseq NM_012192
Protein Refseq NP_036324
MIM 607388
UniProt ID Q9Y5J6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIMM10B Products

Required fields are marked with *

My Review for All TIMM10B Products

Required fields are marked with *

0
cart-icon