Recombinant Human TIMM10B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TIMM10B-6582H |
Product Overview : | FXC1 MS Standard C13 and N15-labeled recombinant protein (NP_036324) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane. |
Molecular Mass : | 11.6 kDa |
AA Sequence : | MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPSVAAEQPGVSPSGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TIMM10B translocase of inner mitochondrial membrane 10B [ Homo sapiens (human) ] |
Official Symbol | TIMM10B |
Synonyms | TIMM10B; translocase of inner mitochondrial membrane 10B; FXC1; Tim9b; TIM10B; mitochondrial import inner membrane translocase subunit Tim10 B; fracture callus 1 homolog; fracture callus protein 1; mitochondrial import inner membrane translocase subunit Tim9 B; translocase of inner mitochondrial membrane 10 homolog B |
Gene ID | 26515 |
mRNA Refseq | NM_012192 |
Protein Refseq | NP_036324 |
MIM | 607388 |
UniProt ID | Q9Y5J6 |
◆ Recombinant Proteins | ||
TIMM10B-4964H | Recombinant Human TIMM10B protein, His-SUMO-tagged | +Inquiry |
TIMM10B-1032H | Recombinant Human TIMM10B Protein, MYC/DDK-tagged | +Inquiry |
Timm10b-6432M | Recombinant Mouse Timm10b Protein, Myc/DDK-tagged | +Inquiry |
TIMM10B-2556Z | Recombinant Zebrafish TIMM10B | +Inquiry |
TIMM10B-6582H | Recombinant Human TIMM10B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMM10B Products
Required fields are marked with *
My Review for All TIMM10B Products
Required fields are marked with *