Recombinant Human TIMM13 Protein, SUMO&His-tagged

Cat.No. : TIMM13-37H
Product Overview : Recombinant Human TIMM13 Protein(Q9Y5L4)(1-95 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-95 aa
Form : Phosphate buffered saline.
Molecular Mass : 23 kDa
AASequence : MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Storage : Store at -20°C to -80°C.
Concentration : 0.1-1.0 mg/ml
Gene Name TIMM13 translocase of inner mitochondrial membrane 13 homolog (yeast) [ Homo sapiens ]
Official Symbol TIMM13
Synonyms TIMM13; translocase of inner mitochondrial membrane 13 homolog (yeast); TIMM13B, translocase of inner mitochondrial membrane 13 (yeast) homolog B; mitochondrial import inner membrane translocase subunit Tim13; Tim13; mitochondrial import inner membrane translocase subunit Tim13B; ppv1; TIM13; TIM13B; TIMM13A; TIMM13B;
Gene ID 26517
mRNA Refseq NM_012458
Protein Refseq NP_036590
MIM 607383
UniProt ID Q9Y5L4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIMM13 Products

Required fields are marked with *

My Review for All TIMM13 Products

Required fields are marked with *

0
cart-icon
0
compare icon