Recombinant Human TIMM13 Protein, MBP&His-tagged

• Cat.No.: TIMM13-38H
• Product Overview: Recombinant Human TIMM13 Protein(Q9Y5L4)(1-95 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&MBP
• Protein Length: 1-95 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 53 kDa
• AASequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
• Storage: Store at -20°C to -80°C.
• Concentration: 0.1-1.0 mg/ml

Gene Information

• Gene Name: TIMM13 translocase of inner mitochondrial membrane 13 homolog (yeast) [ Homo sapiens ]
• Official Symbol: TIMM13
• Synonyms: TIMM13; translocase of inner mitochondrial membrane 13 homolog (yeast); TIMM13B, translocase of inner mitochondrial membrane 13 (yeast) homolog B; mitochondrial import inner membrane translocase subunit Tim13; Tim13; mitochondrial import inner membrane translocase subunit Tim13B; ppv1; TIM13; TIM13B; TIMM13A; TIMM13B
• Gene ID: 26517
• mRNA Refseq: NM_012458
• Protein Refseq: NP_036590
• MIM: 607383
• UniProt ID: Q9Y5L4