Recombinant Human TIMP2 protein, T7/His-tagged
| Cat.No. : | TIMP2-152H |
| Product Overview : | Recombinant human TIMP2 cDNA (27 – 220aa, derived from BC071586) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 27-220 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGECSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEI KQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRY QMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro TIMP2 mediated matrix metalloproteinases activities regulation study for cell differentiation or cancer cell metastasis with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping TMP2 protein-protein interaction.3. Potential biomarker protein for diagnostic/prognosis, such as prostate or lung cancer.4. As immunogen for specific antibody production. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | TIMP2 TIMP metallopeptidase inhibitor 2 [ Homo sapiens ] |
| Official Symbol | TIMP2 |
| Synonyms | TIMP2; TIMP metallopeptidase inhibitor 2; tissue inhibitor of metalloproteinase 2; metalloproteinase inhibitor 2; CSC 21K; TIMP-2; tissue inhibitor of metalloproteinases 2; CSC-21K; |
| Gene ID | 7077 |
| mRNA Refseq | NM_003255 |
| Protein Refseq | NP_003246 |
| MIM | 188825 |
| UniProt ID | P16035 |
| Chromosome Location | 17q25 |
| Pathway | Activation of Matrix Metalloproteinases, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Extracellular matrix organization, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem; |
| Function | enzyme activator activity; enzyme inhibitor activity; integrin binding; metal ion binding; metalloendopeptidase inhibitor activity; |
| ◆ Recombinant Proteins | ||
| TIMP2-3399H | Active Recombinant Human TIMP2 protein, His-GST-tagged | +Inquiry |
| TIMP2-5334B | Active Recombinant Bovine TIMP2 protein, His-tagged | +Inquiry |
| TIMP2-5237H | Recombinant Human TIMP2 protein, GST-tagged | +Inquiry |
| TIMP2-152H | Recombinant Human TIMP2 protein, T7/His-tagged | +Inquiry |
| Timp2-543R | Active Recombinant Rat Timp2 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TIMP2-8460H | Native Human TIMP2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIMP2-2061HCL | Recombinant Human TIMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMP2 Products
Required fields are marked with *
My Review for All TIMP2 Products
Required fields are marked with *
