Recombinant Human TIMP4 protein, His-tagged
| Cat.No. : | TIMP4-4002H |
| Product Overview : | Recombinant Human TIMP4 protein(1 - 224 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1 - 224 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TIMP4 TIMP metallopeptidase inhibitor 4 [ Homo sapiens ] |
| Official Symbol | TIMP4 |
| Synonyms | TIMP4; TIMP metallopeptidase inhibitor 4; tissue inhibitor of metalloproteinase 4; metalloproteinase inhibitor 4; TIMP-4; tissue inhibitor of metalloproteinases 4; |
| Gene ID | 7079 |
| mRNA Refseq | NM_003256 |
| Protein Refseq | NP_003247 |
| MIM | 601915 |
| UniProt ID | Q99727 |
| ◆ Recombinant Proteins | ||
| TIMP4-1541B | Recombinant Bovine TIMP4 Protein (30-224 aa), His-tagged | +Inquiry |
| TIMP4-28M | Recombinant Human TIMP4 protein, Fc-tagged | +Inquiry |
| TIMP4-3243H | Active Recombinant Human TIMP4, MIgG2a Fc-tagged | +Inquiry |
| Timp4-552R | Active Recombinant Rat Timp4 protein, His-tagged | +Inquiry |
| Timp4-550M | Active Recombinant Mouse Timp4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMP4 Products
Required fields are marked with *
My Review for All TIMP4 Products
Required fields are marked with *
