Recombinant Bovine TIMP4 Protein (30-224 aa), His-tagged
Cat.No. : | TIMP4-1541B |
Product Overview : | Recombinant Bovine TIMP4 Protein (30-224 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His |
Protein Length : | 30-224 aa |
Description : | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.5 kDa |
AA Sequence : | CSCAPAHPQQHVCHSALAIRAKISSEKVVPASTDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQILSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TIMP4 TIMP metallopeptidase inhibitor 4 [ Bos taurus (cattle) ] |
Official Symbol | TIMP4 |
Synonyms | TIMP4; Tissue inhibitor of metalloproteinases 4; TIMP-4; |
Gene ID | 317694 |
mRNA Refseq | NM_001045871 |
Protein Refseq | NP_001039336 |
UniProt ID | O97563 |
◆ Recombinant Proteins | ||
Timp4-550M | Recombinant Mouse Timp4 protein, His-tagged | +Inquiry |
Timp4-552R | Recombinant Rat Timp4 protein, His-tagged | +Inquiry |
TIMP4-3244H | Active Recombinant Human TIMP4, HIgG1 Fc-tagged | +Inquiry |
TIMP4-6459H | Recombinant Human TIMP4 Protein (Cys30-Pro224), C-His tagged | +Inquiry |
TIMP4-4538R | Recombinant Rhesus Macaque TIMP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMP4 Products
Required fields are marked with *
My Review for All TIMP4 Products
Required fields are marked with *
0
Inquiry Basket