Recombinant Bovine TIMP4 Protein (30-224 aa), His-tagged

Cat.No. : TIMP4-1541B
Product Overview : Recombinant Bovine TIMP4 Protein (30-224 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : Yeast
Tag : His
Protein Length : 30-224 aa
Description : Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.5 kDa
AA Sequence : CSCAPAHPQQHVCHSALAIRAKISSEKVVPASTDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQILSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name TIMP4 TIMP metallopeptidase inhibitor 4 [ Bos taurus (cattle) ]
Official Symbol TIMP4
Synonyms TIMP4; Tissue inhibitor of metalloproteinases 4; TIMP-4;
Gene ID 317694
mRNA Refseq NM_001045871
Protein Refseq NP_001039336
UniProt ID O97563

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIMP4 Products

Required fields are marked with *

My Review for All TIMP4 Products

Required fields are marked with *

0
cart-icon