Recombinant Human TK2 protein, His&Myc-tagged
Cat.No. : | TK2-3586H |
Product Overview : | Recombinant Human TK2 protein(O00142)(34-265aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 34-265aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.5 kDa |
AA Sequence : | VQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TK2 thymidine kinase 2, mitochondrial [ Homo sapiens ] |
Official Symbol | TK2 |
Synonyms | TK2; thymidine kinase 2, mitochondrial; mt-TK; MTTK; MTDPS2; |
Gene ID | 7084 |
mRNA Refseq | NM_001172643 |
Protein Refseq | NP_001166114 |
MIM | 188250 |
UniProt ID | O00142 |
◆ Recombinant Proteins | ||
TK2-1026C | Recombinant Cynomolgus TK2 Protein, His-tagged | +Inquiry |
TK2-3586H | Recombinant Human TK2 protein, His&Myc-tagged | +Inquiry |
TK2-769C | Recombinant Cynomolgus Monkey TK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TK2-1350H | Recombinant Human Thymidine Kinase 2, Mitochondrial, His-tagged | +Inquiry |
TK2-3107C | Recombinant Chicken TK2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TK2 Products
Required fields are marked with *
My Review for All TK2 Products
Required fields are marked with *
0
Inquiry Basket