Recombinant Human TLCD1 Full Length Transmembrane protein, His-tagged
Cat.No. : | TLCD1-847H |
Product Overview : | Recombinant Human TLCD1 protein(Q96CP7)(36-247aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 36-247aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | TLCD1 TLC domain containing 1 [ Homo sapiens ] |
Official Symbol | TLCD1 |
Gene ID | 116238 |
mRNA Refseq | NM_138463.3 |
Protein Refseq | NP_612472.1 |
UniProt ID | Q96CP7 |
◆ Recombinant Proteins | ||
TLCD1-4541R | Recombinant Rhesus Macaque TLCD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TLCD1-1580Z | Recombinant Zebrafish TLCD1 | +Inquiry |
TLCD1-4727R | Recombinant Rhesus monkey TLCD1 Protein, His-tagged | +Inquiry |
TLCD1-6082R | Recombinant Rat TLCD1 Protein | +Inquiry |
RFL16663RF | Recombinant Full Length Rat Tlc Domain-Containing Protein 1(Tlcd1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLCD1-1052HCL | Recombinant Human TLCD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLCD1 Products
Required fields are marked with *
My Review for All TLCD1 Products
Required fields are marked with *