Recombinant Human TLDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TLDC2-3216H |
Product Overview : | C20orf118 MS Standard C13 and N15-labeled recombinant protein (NP_542195) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TLDC2 (TBC/LysM-Associated Domain Containing 2) is a Protein Coding gene. Diseases associated with TLDC2 include Aicardi-Goutieres Syndrome 5 and Chilblain Lupus 2. An important paralog of this gene is NCOA7. |
Molecular Mass : | 23.9 kDa |
AA Sequence : | MRGLRWRYTRLPSQVEDTLSGEEGNEEEEEEEAAPDPAAAPEDPTVPQLTEASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAWLLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TLDC2 TBC/LysM-associated domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | TLDC2 |
Synonyms | TLDC2; TBC/LysM-associated domain containing 2; C20orf118; TLD domain-containing protein 2; TBC/LysM-associated domain-containing protein 2 |
Gene ID | 140711 |
mRNA Refseq | NM_080628 |
Protein Refseq | NP_542195 |
UniProt ID | A0PJX2 |
◆ Recombinant Proteins | ||
Tldc2-6447M | Recombinant Mouse Tldc2 Protein, Myc/DDK-tagged | +Inquiry |
TLDC2-3216H | Recombinant Human TLDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLDC2-8125HCL | Recombinant Human C20orf118 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLDC2 Products
Required fields are marked with *
My Review for All TLDC2 Products
Required fields are marked with *
0
Inquiry Basket