Recombinant Human TLDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TLDC2-3216H |
| Product Overview : | C20orf118 MS Standard C13 and N15-labeled recombinant protein (NP_542195) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TLDC2 (TBC/LysM-Associated Domain Containing 2) is a Protein Coding gene. Diseases associated with TLDC2 include Aicardi-Goutieres Syndrome 5 and Chilblain Lupus 2. An important paralog of this gene is NCOA7. |
| Molecular Mass : | 23.9 kDa |
| AA Sequence : | MRGLRWRYTRLPSQVEDTLSGEEGNEEEEEEEAAPDPAAAPEDPTVPQLTEASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAWLLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TLDC2 TBC/LysM-associated domain containing 2 [ Homo sapiens (human) ] |
| Official Symbol | TLDC2 |
| Synonyms | TLDC2; TBC/LysM-associated domain containing 2; C20orf118; TLD domain-containing protein 2; TBC/LysM-associated domain-containing protein 2 |
| Gene ID | 140711 |
| mRNA Refseq | NM_080628 |
| Protein Refseq | NP_542195 |
| UniProt ID | A0PJX2 |
| ◆ Recombinant Proteins | ||
| Tldc2-6447M | Recombinant Mouse Tldc2 Protein, Myc/DDK-tagged | +Inquiry |
| TLDC2-3216H | Recombinant Human TLDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TLDC2-8125HCL | Recombinant Human C20orf118 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLDC2 Products
Required fields are marked with *
My Review for All TLDC2 Products
Required fields are marked with *



