Recombinant Human TLN2 Protein (88-406 aa), His-tagged
Cat.No. : | TLN2-1736H |
Product Overview : | Recombinant Human TLN2 Protein (88-406 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 88-406 aa |
Description : | As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.1 kDa |
AA Sequence : | RPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TLN2 talin 2 [ Homo sapiens ] |
Official Symbol | TLN2 |
Synonyms | TLN2; talin 2; talin-2; ILWEQ; KIAA0320; DKFZp451B1011; DKFZp686I0976; DKFZp686K0979; |
Gene ID | 83660 |
mRNA Refseq | NM_015059 |
Protein Refseq | NP_055874 |
MIM | 607349 |
UniProt ID | Q9Y4G6 |
◆ Recombinant Proteins | ||
TLN2-642H | Recombinant Human TLN2 Protein, His-tagged | +Inquiry |
TLN2-1736H | Recombinant Human TLN2 Protein (88-406 aa), His-tagged | +Inquiry |
TLN2-1171H | Recombinant Human TLN2 Protein (88-406 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLN2 Products
Required fields are marked with *
My Review for All TLN2 Products
Required fields are marked with *
0
Inquiry Basket