Recombinant Human TLR1 Protein (25-580 aa), His-tagged
Cat.No. : | TLR1-1815H |
Product Overview : | Recombinant Human TLR1 Protein (25-580 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 25-580 aa |
Description : | Participates in the innate immune response to microbial agents. Specifically recognizes diacylated and triacylated lipopeptides. Cooperates with TLR2 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 65.2 kDa |
AA Sequence : | SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNIT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TLR1 toll-like receptor 1 [ Homo sapiens ] |
Official Symbol | TLR1 |
Synonyms | TLR1; CD281; KIAA0012; rsc786; TIL; TIL. LPRS5; MGC104956; MGC126311; MGC126312; DKFZp547I0610; DKFZp564I0682; |
Gene ID | 7096 |
mRNA Refseq | NM_003263 |
Protein Refseq | NP_003254 |
MIM | 601194 |
UniProt ID | Q15399 |
◆ Recombinant Proteins | ||
Tlr1-2070M | Recombinant Mouse Tlr1 protein, His & GST-tagged | +Inquiry |
TLR1-1815H | Recombinant Human TLR1 Protein (25-580 aa), His-tagged | +Inquiry |
TLR1-145H | Recombinant Human TLR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TLR1-1666R | Recombinant Rhesus Monkey TLR1 Protein, hIgG4-tagged | +Inquiry |
TLR1-1665R | Recombinant Rhesus Monkey TLR1 Protein, hIgG1-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR1-1047HCL | Recombinant Human TLR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR1 Products
Required fields are marked with *
My Review for All TLR1 Products
Required fields are marked with *
0
Inquiry Basket