Recombinant Human TLR2 protein, GST-tagged
| Cat.No. : | TLR2-30423TH |
| Product Overview : | Recombinant Human TLR2(201 a.a. - 300 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 201-300 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | SHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TLR2 toll-like receptor 2 [ Homo sapiens ] |
| Official Symbol | TLR2 |
| Synonyms | TLR2; toll-like receptor 2; CD282; TIL4; toll/interleukin 1 receptor-like 4; toll/interleukin-1 receptor-like protein 4; |
| Gene ID | 7097 |
| mRNA Refseq | NM_003264 |
| Protein Refseq | NP_003255 |
| MIM | 603028 |
| UniProt ID | O60603 |
| Chromosome Location | 4q32 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Beta defensins, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Defensins, organism-specific biosystem; |
| Function | Gram-positive bacterial cell surface binding; lipopolysaccharide receptor activity; pattern recognition receptor activity; peptidoglycan binding; protein binding; protein heterodimerization activity; receptor activity; transmembrane signaling receptor activity; triacyl lipopeptide binding; |
| ◆ Recombinant Proteins | ||
| TLR2-151H | Recombinant Human TLR2 Protein, DYKDDDDK-tagged | +Inquiry |
| RFL10018GF | Recombinant Full Length Giraffa Camelopardalis Toll-Like Receptor 2(Tlr2) Protein, His-Tagged | +Inquiry |
| TLR2-744H | Recombinant Human TLR2 protein, His-tagged | +Inquiry |
| TLR2-5135H | Recombinant Human TLR2 Protein (Met1-Arg587), C-His tagged | +Inquiry |
| Tlr2-7396M | Recombinant Mouse Tlr2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TLR2-001MCL | Recombinant Mouse TLR2 cell lysate | +Inquiry |
| TLR2-439HCL | Recombinant Human TLR2 cell lysate | +Inquiry |
| TLR2-001RCL | Recombinant Rat TLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLR2 Products
Required fields are marked with *
My Review for All TLR2 Products
Required fields are marked with *
