Recombinant Human TLR2 protein, GST-tagged
Cat.No. : | TLR2-30423TH |
Product Overview : | Recombinant Human TLR2(201 a.a. - 300 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 201-300 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TLR2 toll-like receptor 2 [ Homo sapiens ] |
Official Symbol | TLR2 |
Synonyms | TLR2; toll-like receptor 2; CD282; TIL4; toll/interleukin 1 receptor-like 4; toll/interleukin-1 receptor-like protein 4; |
Gene ID | 7097 |
mRNA Refseq | NM_003264 |
Protein Refseq | NP_003255 |
MIM | 603028 |
UniProt ID | O60603 |
Chromosome Location | 4q32 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Beta defensins, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Defensins, organism-specific biosystem; |
Function | Gram-positive bacterial cell surface binding; lipopolysaccharide receptor activity; pattern recognition receptor activity; peptidoglycan binding; protein binding; protein heterodimerization activity; receptor activity; transmembrane signaling receptor activity; triacyl lipopeptide binding; |
◆ Cell & Tissue Lysates | ||
TLR2-001MCL | Recombinant Mouse TLR2 cell lysate | +Inquiry |
TLR2-439HCL | Recombinant Human TLR2 cell lysate | +Inquiry |
TLR2-001RCL | Recombinant Rat TLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR2 Products
Required fields are marked with *
My Review for All TLR2 Products
Required fields are marked with *
0
Inquiry Basket