Recombinant Human TLR4
Cat.No. : | TLR4-29825TH |
Product Overview : | Recombinant fragment of Human TLR4 with a proprietary tag; predicted mwt: 34.21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 78 amino acids |
Description : | The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain. |
Molecular Weight : | 34.210kDa inclusive of tags |
Tissue specificity : | Highly expressed in placenta, spleen and peripheral blood leukocytes. Detected in monocytes, macrophages, dendritic cells and several types of T-cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA |
Sequence Similarities : | Belongs to the Toll-like receptor family.Contains 18 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.Contains 1 TIR domain. |
Gene Name | TLR4 toll-like receptor 4 [ Homo sapiens ] |
Official Symbol | TLR4 |
Synonyms | TLR4; toll-like receptor 4; CD284; hToll; |
Gene ID | 7099 |
mRNA Refseq | NM_138554 |
Protein Refseq | NP_612564 |
Uniprot ID | O00206 |
Chromosome Location | 9q33.1 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; |
Function | lipopolysaccharide binding; lipopolysaccharide binding; lipopolysaccharide receptor activity; phosphatidylinositol 3-kinase binding; protein binding; |
◆ Recombinant Proteins | ||
Tlr4-2401R | Recombinant Rat Tlr4 protein, His-SUMO & Myc-tagged | +Inquiry |
TLR4-614HFL | Recombinant Full Length Human TLR4 Protein, C-Flag-tagged | +Inquiry |
Tlr4-02M | Active Recombinant Mouse Tlr4 Protein, Fc-tagged | +Inquiry |
TLR4-7618H | Recombinant Human TLR4 protein, His & T7-tagged | +Inquiry |
TLR4-40689H | Active Recombinant Human TLR4 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR4-402HCL | Recombinant Human TLR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR4 Products
Required fields are marked with *
My Review for All TLR4 Products
Required fields are marked with *
0
Inquiry Basket