Recombinant Human TLR4

Cat.No. : TLR4-29825TH
Product Overview : Recombinant fragment of Human TLR4 with a proprietary tag; predicted mwt: 34.21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 78 amino acids
Description : The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain.
Molecular Weight : 34.210kDa inclusive of tags
Tissue specificity : Highly expressed in placenta, spleen and peripheral blood leukocytes. Detected in monocytes, macrophages, dendritic cells and several types of T-cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA
Sequence Similarities : Belongs to the Toll-like receptor family.Contains 18 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.Contains 1 TIR domain.
Gene Name TLR4 toll-like receptor 4 [ Homo sapiens ]
Official Symbol TLR4
Synonyms TLR4; toll-like receptor 4; CD284; hToll;
Gene ID 7099
mRNA Refseq NM_138554
Protein Refseq NP_612564
Uniprot ID O00206
Chromosome Location 9q33.1
Pathway Activated TLR4 signalling, organism-specific biosystem; Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem;
Function lipopolysaccharide binding; lipopolysaccharide binding; lipopolysaccharide receptor activity; phosphatidylinositol 3-kinase binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TLR4 Products

Required fields are marked with *

My Review for All TLR4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon