Recombinant Human TLR5

Cat.No. : TLR5-30142TH
Product Overview : Recombinant fragment of Human TLR5 with a proprietary tag; predicted mwt: 38.61 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 118 amino acids
Description : This gene encodes a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB, which in turn activates a host of inflammatory-related target genes. Mutations in this gene have been associated with both resistance and susceptibility to systemic lupus erythematosus, and susceptibility to Legionnaire disease.
Molecular Weight : 38.610kDa inclusive of tags
Tissue specificity : Highly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV
Sequence Similarities : Belongs to the Toll-like receptor family.Contains 15 LRR (leucine-rich) repeats.Contains 1 TIR domain.
Gene Name TLR5 toll-like receptor 5 [ Homo sapiens ]
Official Symbol TLR5
Synonyms TLR5; toll-like receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3; Toll/interleukin 1 receptor like protein 3;
Gene ID 7100
mRNA Refseq NM_003268
Protein Refseq NP_003259
MIM 603031
Uniprot ID O60602
Chromosome Location 1q32.3-q42
Pathway Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem;
Function interleukin-1 receptor binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TLR5 Products

Required fields are marked with *

My Review for All TLR5 Products

Required fields are marked with *

0
cart-icon