Recombinant Human TLR5
Cat.No. : | TLR5-30142TH |
Product Overview : | Recombinant fragment of Human TLR5 with a proprietary tag; predicted mwt: 38.61 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 118 amino acids |
Description : | This gene encodes a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB, which in turn activates a host of inflammatory-related target genes. Mutations in this gene have been associated with both resistance and susceptibility to systemic lupus erythematosus, and susceptibility to Legionnaire disease. |
Molecular Weight : | 38.610kDa inclusive of tags |
Tissue specificity : | Highly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV |
Sequence Similarities : | Belongs to the Toll-like receptor family.Contains 15 LRR (leucine-rich) repeats.Contains 1 TIR domain. |
Gene Name | TLR5 toll-like receptor 5 [ Homo sapiens ] |
Official Symbol | TLR5 |
Synonyms | TLR5; toll-like receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3; Toll/interleukin 1 receptor like protein 3; |
Gene ID | 7100 |
mRNA Refseq | NM_003268 |
Protein Refseq | NP_003259 |
MIM | 603031 |
Uniprot ID | O60602 |
Chromosome Location | 1q32.3-q42 |
Pathway | Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; |
Function | interleukin-1 receptor binding; receptor activity; |
◆ Recombinant Proteins | ||
TLR5-4548R | Recombinant Rhesus Macaque TLR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
TLR5-902H | Recombinant Human TLR5 protein, MYC/DDK-tagged | +Inquiry |
TLR5-4734R | Recombinant Rhesus monkey TLR5 Protein, His-tagged | +Inquiry |
TLR5-2954H | Recombinant Human TLR5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TLR5-2076H | Recombinant Human TLR5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR5-1045HCL | Recombinant Human TLR5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLR5 Products
Required fields are marked with *
My Review for All TLR5 Products
Required fields are marked with *