Recombinant Human TLR9 Protein, Alexa-647 labeled

Cat.No. : TLR9-48HA
Product Overview : Recombinant Human TLR9 protein without tag was expressed in E. coli. Purified protein was labeled with alexa-647 in vitro.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural andfunctional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylatedCpG dinucleotides in bacterial DNA to mount an innate immune response.
Conjugation/Label : Alexa-647
Molecular Mass : 41.2kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-TLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSFGS
Purity : > 95%
Applications : SDS-PAGE; WB; ELISA; IP
Concentration : 1.0 mg/mL
Gene Name TLR9 toll-like receptor 9 [ Homo sapiens (human) ]
Official Symbol TLR9
Synonyms TLR9; toll-like receptor 9; CD289
Gene ID 54106
mRNA Refseq NM_017442
Protein Refseq NP_059138
MIM 605474
UniProt ID Q9NR96

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TLR9 Products

Required fields are marked with *

My Review for All TLR9 Products

Required fields are marked with *

0
cart-icon