Recombinant Human TLR9 Protein, Alexa-647 labeled
Cat.No. : | TLR9-48HA |
Product Overview : | Recombinant Human TLR9 protein without tag was expressed in E. coli. Purified protein was labeled with alexa-647 in vitro. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural andfunctional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylatedCpG dinucleotides in bacterial DNA to mount an innate immune response. |
Conjugation/Label : | Alexa-647 |
Molecular Mass : | 41.2kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-TLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSFGS |
Purity : | > 95% |
Applications : | SDS-PAGE; WB; ELISA; IP |
Concentration : | 1.0 mg/mL |
Gene Name | TLR9 toll-like receptor 9 [ Homo sapiens (human) ] |
Official Symbol | TLR9 |
Synonyms | TLR9; toll-like receptor 9; CD289 |
Gene ID | 54106 |
mRNA Refseq | NM_017442 |
Protein Refseq | NP_059138 |
MIM | 605474 |
UniProt ID | Q9NR96 |
◆ Recombinant Proteins | ||
TLR9-7078Z | Recombinant Zebrafish TLR9 | +Inquiry |
Tlr9-696M | Recombinant Mouse Tlr9 protein, His & GST-tagged | +Inquiry |
Tlr9-697R | Recombinant Rat Tlr9 protein, His & T7-tagged | +Inquiry |
TLR9-16831M | Recombinant Mouse TLR9 Protein | +Inquiry |
TLR9-9240M | Recombinant Mouse TLR9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR9-1042HCL | Recombinant Human TLR9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR9 Products
Required fields are marked with *
My Review for All TLR9 Products
Required fields are marked with *
0
Inquiry Basket