Recombinant Human TM4SF1 Protein (115-161 aa), His-tagged

Cat.No. : TM4SF1-1857H
Product Overview : Recombinant Human TM4SF1 Protein (115-161 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 115-161 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 7.3 kDa
AA Sequence : LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name TM4SF1 transmembrane 4 superfamily member 1 [ Homo sapiens ]
Official Symbol TM4SF1
Synonyms TM4SF1; transmembrane 4 superfamily member 1;
Gene ID 9004
UniProt ID P30408

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TM4SF1 Products

Required fields are marked with *

My Review for All TM4SF1 Products

Required fields are marked with *

0
cart-icon