Recombinant Human TM4SF1 Protein (115-161 aa), His-tagged

• Cat.No.: TM4SF1-1857H
• Product Overview: Recombinant Human TM4SF1 Protein (115-161 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 115-161 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 7.3 kDa
• AA Sequence: LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: TM4SF1 transmembrane 4 superfamily member 1 [ Homo sapiens ]
• Official Symbol: TM4SF1
• Synonyms: TM4SF1; transmembrane 4 superfamily member 1
• Gene ID: 9004
• UniProt ID: P30408