Recombinant Human TM4SF1 Protein (115-161 aa), His-tagged
Cat.No. : | TM4SF1-1857H |
Product Overview : | Recombinant Human TM4SF1 Protein (115-161 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 115-161 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 7.3 kDa |
AA Sequence : | LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TM4SF1 transmembrane 4 superfamily member 1 [ Homo sapiens ] |
Official Symbol | TM4SF1 |
Synonyms | TM4SF1; transmembrane 4 superfamily member 1; |
Gene ID | 9004 |
UniProt ID | P30408 |
◆ Recombinant Proteins | ||
TM4SF1-4554R | Recombinant Rhesus Macaque TM4SF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TM4SF1-9245M | Recombinant Mouse TM4SF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TM4SF1-3262H | Recombinant Human TM4SF1, GST-tagged | +Inquiry |
TM4SF1-1857H | Recombinant Human TM4SF1 Protein (115-161 aa), His-tagged | +Inquiry |
TM4SF1-2942H | Active Recombinant Human TM4SF1 Full Length Transmembrane protein(MNP) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TM4SF1-667HCL | Recombinant Human TM4SF1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TM4SF1 Products
Required fields are marked with *
My Review for All TM4SF1 Products
Required fields are marked with *