Recombinant Human TMBIM6 protein, His-tagged
| Cat.No. : | TMBIM6-3008H |
| Product Overview : | Recombinant Human TMBIM6 protein(1-86 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-86 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TMBIM6 transmembrane BAX inhibitor motif containing 6 [ Homo sapiens ] |
| Official Symbol | TMBIM6 |
| Synonyms | TMBIM6; transmembrane BAX inhibitor motif containing 6; TEGT, testis enhanced gene transcript; bax inhibitor 1; BAX inhibitor 1; BAXI1; BI 1; testis enhanced gene transcript; testis-enhanced gene transcript protein; transmembrane BAX inhibitor motif-containing protein 6; BI-1; TEGT; |
| Gene ID | 7009 |
| mRNA Refseq | NM_001098576 |
| Protein Refseq | NP_001092046 |
| MIM | 600748 |
| UniProt ID | P55061 |
| ◆ Recombinant Proteins | ||
| TMBIM6-6092R | Recombinant Rat TMBIM6 Protein | +Inquiry |
| RFL33427BF | Recombinant Full Length Bovine Bax Inhibitor 1(Tmbim6) Protein, His-Tagged | +Inquiry |
| TMBIM6-5749R | Recombinant Rat TMBIM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMBIM6-16854M | Recombinant Mouse TMBIM6 Protein | +Inquiry |
| RFL31858SF | Recombinant Full Length Pig Bax Inhibitor 1(Tmbim6) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMBIM6-1029HCL | Recombinant Human TMBIM6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMBIM6 Products
Required fields are marked with *
My Review for All TMBIM6 Products
Required fields are marked with *
