Recombinant Human TMBIM6 protein, His-tagged
Cat.No. : | TMBIM6-3008H |
Product Overview : | Recombinant Human TMBIM6 protein(1-86 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-86 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TMBIM6 transmembrane BAX inhibitor motif containing 6 [ Homo sapiens ] |
Official Symbol | TMBIM6 |
Synonyms | TMBIM6; transmembrane BAX inhibitor motif containing 6; TEGT, testis enhanced gene transcript; bax inhibitor 1; BAX inhibitor 1; BAXI1; BI 1; testis enhanced gene transcript; testis-enhanced gene transcript protein; transmembrane BAX inhibitor motif-containing protein 6; BI-1; TEGT; |
Gene ID | 7009 |
mRNA Refseq | NM_001098576 |
Protein Refseq | NP_001092046 |
MIM | 600748 |
UniProt ID | P55061 |
◆ Recombinant Proteins | ||
RFL26358PF | Recombinant Full Length Paralichthys Olivaceus Probable Bax Inhibitor 1(Tmbim6) Protein, His-Tagged | +Inquiry |
TMBIM6-5749R | Recombinant Rat TMBIM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMBIM6-9255M | Recombinant Mouse TMBIM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMBIM6-6092R | Recombinant Rat TMBIM6 Protein | +Inquiry |
RFL6549PF | Recombinant Full Length Pongo Abelii Bax Inhibitor 1(Tmbim6) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMBIM6-1029HCL | Recombinant Human TMBIM6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMBIM6 Products
Required fields are marked with *
My Review for All TMBIM6 Products
Required fields are marked with *