Recombinant Human TMC2 protein, GST-tagged

• Cat.No.: TMC2-301391H
• Product Overview: Recombinant Human TMC2 (805-906 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met805-His906
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TMC2 transmembrane channel-like 2 [ Homo sapiens ]
• Official Symbol: TMC2
• Synonyms: TMC2; transmembrane channel-like 2; C20orf145, transmembrane, cochlear expressed, 2; transmembrane channel-like protein 2; dJ686C3.3; transmembrane, cochlear expressed, 2; transmembrane cochlear-expressed protein 2; C20orf145
• Gene ID: 117532
• mRNA Refseq: NM_080751
• Protein Refseq: NP_542789
• MIM: 606707
• UniProt ID: Q8TDI7