Recombinant Human TMC2 protein, His-tagged

Cat.No. : TMC2-6843H
Product Overview : Recombinant Human TMC2 protein(805-906 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 805-906 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol TMC2
Synonyms TMC2; transmembrane channel-like 2; C20orf145, transmembrane, cochlear expressed, 2; transmembrane channel-like protein 2; dJ686C3.3; transmembrane, cochlear expressed, 2; transmembrane cochlear-expressed protein 2; C20orf145;
Gene ID 117532
mRNA Refseq NM_080751
Protein Refseq NP_542789
MIM 606707
UniProt ID Q8TDI7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMC2 Products

Required fields are marked with *

My Review for All TMC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon