Recombinant Human TMC2 protein, His-tagged
Cat.No. : | TMC2-6843H |
Product Overview : | Recombinant Human TMC2 protein(805-906 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 805-906 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | TMC2 |
Synonyms | TMC2; transmembrane channel-like 2; C20orf145, transmembrane, cochlear expressed, 2; transmembrane channel-like protein 2; dJ686C3.3; transmembrane, cochlear expressed, 2; transmembrane cochlear-expressed protein 2; C20orf145; |
Gene ID | 117532 |
mRNA Refseq | NM_080751 |
Protein Refseq | NP_542789 |
MIM | 606707 |
UniProt ID | Q8TDI7 |
◆ Recombinant Proteins | ||
TMC2-3380C | Recombinant Chicken TMC2 | +Inquiry |
TMC2-301391H | Recombinant Human TMC2 protein, GST-tagged | +Inquiry |
TMC2-6843H | Recombinant Human TMC2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMC2 Products
Required fields are marked with *
My Review for All TMC2 Products
Required fields are marked with *
0
Inquiry Basket