Recombinant Human TMC2 protein, His-tagged

• Cat.No.: TMC2-6843H
• Product Overview: Recombinant Human TMC2 protein(805-906 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 805-906 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: TMC2
• Synonyms: TMC2; transmembrane channel-like 2; C20orf145, transmembrane, cochlear expressed, 2; transmembrane channel-like protein 2; dJ686C3.3; transmembrane, cochlear expressed, 2; transmembrane cochlear-expressed protein 2; C20orf145
• Gene ID: 117532
• mRNA Refseq: NM_080751
• Protein Refseq: NP_542789
• MIM: 606707
• UniProt ID: Q8TDI7