Recombinant Human TMC5 Protein, His-tagged
| Cat.No. : | TMC5-30H |
| Product Overview : | Recombinant Human TMC5 Protein(Q6UXY8)(11-350 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 11-350 aa |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 40 kDa |
| AASequence : | EEDPDYPDYSGSQNRTQGYLKTQGYPDVPGPLNNPDYPGTRSNPYSVASRTRPDYPGSLAEPNYPRSLSNPDYSGTRSNAYSAASRTSPDHPTSLPEPDYSEFQSHPYHRASSRQPDYPGSQRNPDFAGSSSSGNYAGSRTHPDHFGSLEPDYPGAQSNSDHPGPRANLNHPGSRKNLEHTSFRINPYADSLGKPDYPGADIQPNSPPFFGEPDYPSAEDNQNLPSTWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGSLWGENDYPEGIEMASMEMANSYGHSLPGAPGSGYVNPAYVGESGPVHAYGNPPLSECDWHKSPQG |
| Storage : | Store at -20°C/-80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | TMC5 transmembrane channel-like 5 [ Homo sapiens ] |
| Official Symbol | TMC5 |
| Synonyms | TMC5; transmembrane channel-like 5; transmembrane channel-like protein 5; FLJ13593; |
| Gene ID | 79838 |
| mRNA Refseq | NM_001105248 |
| Protein Refseq | NP_001098718 |
| UniProt ID | Q6UXY8 |
| ◆ Recombinant Proteins | ||
| TMC5-16859M | Recombinant Mouse TMC5 Protein | +Inquiry |
| TMC5-31H | Recombinant Human TMC5 Protein, His-tagged | +Inquiry |
| TMC5-30H | Recombinant Human TMC5 Protein, His-tagged | +Inquiry |
| TMC5-9257M | Recombinant Mouse TMC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMC5-3266H | Recombinant Human TMC5, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMC5 Products
Required fields are marked with *
My Review for All TMC5 Products
Required fields are marked with *
