Recombinant Human TMC5 Protein, His-tagged

Cat.No. : TMC5-31H
Product Overview : Recombinant Human TMC5 Protein(Q6UXY8)(141-300 aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 141-300 aa
Form : Phosphate buffered saline
Molecular Mass : 20 kDa
AASequence : SSSGNYAGSRTHPDHFGSLEPDYPGAQSNSDHPGPRANLNHPGSRKNLEHTSFRINPYADSLGKPDYPGADIQPNSPPFFGEPDYPSAEDNQNLPSTWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGSLWGENDYPEGIEMAS
Storage : Store at -20°C/-80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name TMC5 transmembrane channel-like 5 [ Homo sapiens ]
Official Symbol TMC5
Synonyms TMC5; transmembrane channel-like 5; transmembrane channel-like protein 5; FLJ13593;
Gene ID 79838
mRNA Refseq NM_001105248
Protein Refseq NP_001098718
UniProt ID Q6UXY8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMC5 Products

Required fields are marked with *

My Review for All TMC5 Products

Required fields are marked with *

0
cart-icon
0
compare icon