Recombinant Human TMC5 Protein, His-tagged

• Cat.No.: TMC5-31H
• Product Overview: Recombinant Human TMC5 Protein(Q6UXY8)(141-300 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 141-300 aa
• Form: Phosphate buffered saline
• Molecular Mass: 20 kDa
• AASequence: SSSGNYAGSRTHPDHFGSLEPDYPGAQSNSDHPGPRANLNHPGSRKNLEHTSFRINPYADSLGKPDYPGADIQPNSPPFFGEPDYPSAEDNQNLPSTWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGSLWGENDYPEGIEMAS
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TMC5 transmembrane channel-like 5 [ Homo sapiens ]
• Official Symbol: TMC5
• Synonyms: TMC5; transmembrane channel-like 5; transmembrane channel-like protein 5; FLJ13593
• Gene ID: 79838
• mRNA Refseq: NM_001105248
• Protein Refseq: NP_001098718
• UniProt ID: Q6UXY8