Recombinant Human TMC7 Protein, N-His6-ABP tagged
Cat.No. : | TMC7-04H |
Product Overview : | Recombinant Human TMC7 Protein with a N-terminal His6-ABP tag was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | ABP&His |
Description : | Predicted to enable mechanosensitive ion channel activity. Predicted to be involved in ion transmembrane transport. Predicted to be integral component of plasma membrane. |
Molecular Mass : | 32 kDa |
AA Sequence : | LDSSCFSSPPVNFLQELPSYRSIARRRTTVHSRDKQSGTLLKPTDSYSSQLEDRIAENLSSHSLRNYALNISEKRRLRDIQETQMKYLSEWDQWKRYSSKSWKRFLEKAREMTTHLE |
Purity : | > 80% by SDS-PAGE and Coomassie blue staining |
Applications : | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody. |
Storage : | Store at -20 centigrade. Avoid freeze-thaw cycles. |
Concentration : | It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/mL. |
Storage Buffer : | PBS and 1M Urea, pH 7.4. |
Gene Name | TMC7 transmembrane channel-like 7 [ Homo sapiens (human) ] |
Official Symbol | TMC7 |
Synonyms | TMC7; transmembrane channel-like 7; transmembrane channel-like protein 7; FLJ21240; DKFZp781O2274; |
Gene ID | 79905 |
mRNA Refseq | NM_001160364 |
Protein Refseq | NP_001153836 |
MIM | 617198 |
UniProt ID | Q7Z402 |
◆ Recombinant Proteins | ||
TMC7-9258M | Recombinant Mouse TMC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMC7-771C | Recombinant Cynomolgus Monkey TMC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMC7-1028C | Recombinant Cynomolgus TMC7 Protein, His-tagged | +Inquiry |
TMC7-4562R | Recombinant Rhesus Macaque TMC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMC7-4748R | Recombinant Rhesus monkey TMC7 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMC7 Products
Required fields are marked with *
My Review for All TMC7 Products
Required fields are marked with *