Recombinant Human TMC7 Protein, N-His6-ABP tagged

Cat.No. : TMC7-04H
Product Overview : Recombinant Human TMC7 Protein with a N-terminal His6-ABP tag was produced in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : ABP&His
Description : Predicted to enable mechanosensitive ion channel activity. Predicted to be involved in ion transmembrane transport. Predicted to be integral component of plasma membrane.
Molecular Mass : 32 kDa
AA Sequence : LDSSCFSSPPVNFLQELPSYRSIARRRTTVHSRDKQSGTLLKPTDSYSSQLEDRIAENLSSHSLRNYALNISEKRRLRDIQETQMKYLSEWDQWKRYSSKSWKRFLEKAREMTTHLE
Purity : > 80% by SDS-PAGE and Coomassie blue staining
Applications : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody.
Storage : Store at -20 centigrade. Avoid freeze-thaw cycles.
Concentration : It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/mL.
Storage Buffer : PBS and 1M Urea, pH 7.4.
Gene Name TMC7 transmembrane channel-like 7 [ Homo sapiens (human) ]
Official Symbol TMC7
Synonyms TMC7; transmembrane channel-like 7; transmembrane channel-like protein 7; FLJ21240; DKFZp781O2274;
Gene ID 79905
mRNA Refseq NM_001160364
Protein Refseq NP_001153836
MIM 617198
UniProt ID Q7Z402

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMC7 Products

Required fields are marked with *

My Review for All TMC7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon