Recombinant Human TMED2 Protein, His-tagged

• Cat.No.: TMED2-33H
• Product Overview: Recombinant Human TMED2 Protein(Q15363)(31-150 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 31-150 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 16 kDa
• AASequence: ECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEY
• Storage: Store at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TMED2 transmembrane emp24 domain trafficking protein 2 [ Homo sapiens ]
• Official Symbol: TMED2
• Synonyms: TMED2; transmembrane emp24 domain trafficking protein 2; transmembrane emp24 domain-containing protein 2; P24A; RNP24; p24beta1; membrane protein p24A; p24 family protein beta-1; coated vesicle membrane protein; p24; FLJ21323
• Gene ID: 10959
• mRNA Refseq: NM_006815
• Protein Refseq: NP_006806
• UniProt ID: Q15363