Recombinant Human TMED6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMED6-4148H
Product Overview : TMED6 MS Standard C13 and N15-labeled recombinant protein (NP_653277) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TMED6 (Transmembrane P24 Trafficking Protein 6) is a Protein Coding gene. An important paralog of this gene is ENSG00000259900.
Molecular Mass : 27.6 kDa
AA Sequence : MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSCEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMED6 transmembrane p24 trafficking protein 6 [ Homo sapiens (human) ]
Official Symbol TMED6
Synonyms TMED6; transmembrane p24 trafficking protein 6; p24g5; PRO34237; SPLL9146; transmembrane emp24 domain-containing protein 6; p24 family protein gamma-5; p24gamma5; transmembrane emp24 protein transport domain containing 6
Gene ID 146456
mRNA Refseq NM_144676
Protein Refseq NP_653277
UniProt ID Q8WW62

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMED6 Products

Required fields are marked with *

My Review for All TMED6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon