Recombinant Human TMEFF2 protein, His-tagged

• Cat.No.: TMEFF2-5433H
• Product Overview: Recombinant Human TMEFF2 protein(Q9UIK5)(41-320aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 41-320aa
• Tag: C-His
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody, the EC50 is 2.129-2.956 ng/mL.
• Molecular Mass: 32.3 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV

Gene Information

• Gene Name: TMEFF2 transmembrane protein with EGF-like and two follistatin-like domains 2 [ Homo sapiens ]
• Official Symbol: TMEFF2
• Synonyms: TMEFF2; transmembrane protein with EGF-like and two follistatin-like domains 2; tomoregulin-2; cancer/testis antigen family 120; member 2; CT120.2; HPP1; TENB2; tomoregulin; TPEF; TR; transmembrane protein TENB2; TR-2; hyperplastic polyposis protein 1; cancer/testis antigen family 120, member 2
• Gene ID: 23671
• mRNA Refseq: NM_016192
• Protein Refseq: NP_057276
• MIM: 605734
• UniProt ID: Q9UIK5