Recombinant Human TMEFF2 protein, His-tagged
Cat.No. : | TMEFF2-5433H |
Product Overview : | Recombinant Human TMEFF2 protein(Q9UIK5)(41-320aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 41-320aa |
Tag : | C-His |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody, the EC50 is 2.129-2.956 ng/mL. |
Molecular Mass : | 32.3 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV |
Gene Name | TMEFF2 transmembrane protein with EGF-like and two follistatin-like domains 2 [ Homo sapiens ] |
Official Symbol | TMEFF2 |
Synonyms | TMEFF2; transmembrane protein with EGF-like and two follistatin-like domains 2; tomoregulin-2; cancer/testis antigen family 120; member 2; CT120.2; HPP1; TENB2; tomoregulin; TPEF; TR; transmembrane protein TENB2; TR-2; hyperplastic polyposis protein 1; cancer/testis antigen family 120, member 2; |
Gene ID | 23671 |
mRNA Refseq | NM_016192 |
Protein Refseq | NP_057276 |
MIM | 605734 |
UniProt ID | Q9UIK5 |
◆ Recombinant Proteins | ||
TMEFF2-5780H | Recombinant Human TMEFF2 Protein (Thr52-Arg290), N-His tagged | +Inquiry |
TMEFF2-1413H | Recombinant Human TMEFF2 protein, His & T7-tagged | +Inquiry |
TMEFF2-16884M | Recombinant Mouse TMEFF2 Protein | +Inquiry |
TMEFF2-9273M | Recombinant Mouse TMEFF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEFF2-475H | Active Recombinant Human TMEFF2 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEFF2-1019HCL | Recombinant Human TMEFF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEFF2 Products
Required fields are marked with *
My Review for All TMEFF2 Products
Required fields are marked with *
0
Inquiry Basket