Recombinant Human TMEFF2 protein, His-tagged

Cat.No. : TMEFF2-5433H
Product Overview : Recombinant Human TMEFF2 protein(Q9UIK5)(41-320aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 41-320aa
Tag : C-His
Form : Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody, the EC50 is 2.129-2.956 ng/mL.
Molecular Mass : 32.3 kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV
Gene Name TMEFF2 transmembrane protein with EGF-like and two follistatin-like domains 2 [ Homo sapiens ]
Official Symbol TMEFF2
Synonyms TMEFF2; transmembrane protein with EGF-like and two follistatin-like domains 2; tomoregulin-2; cancer/testis antigen family 120; member 2; CT120.2; HPP1; TENB2; tomoregulin; TPEF; TR; transmembrane protein TENB2; TR-2; hyperplastic polyposis protein 1; cancer/testis antigen family 120, member 2;
Gene ID 23671
mRNA Refseq NM_016192
Protein Refseq NP_057276
MIM 605734
UniProt ID Q9UIK5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEFF2 Products

Required fields are marked with *

My Review for All TMEFF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon