Recombinant Human TMEM106B Protein, GST-tagged
Cat.No. : | TMEM106B-33H |
Product Overview : | Recombinant Human TMEM106B Protein(1-46 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-46 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TMEM106B transmembrane protein 106B [ Homo sapiens ] |
Official Symbol | TMEM106B |
Synonyms | TMEM106B; transmembrane protein 106B; FLJ11273; MGC33727 |
Gene ID | 54664 |
mRNA Refseq | NM_001134232 |
Protein Refseq | NP_001127704 |
MIM | 613413 |
UniProt ID | Q9NUM4 |
◆ Recombinant Proteins | ||
Tmem106b-4656M | Recombinant Mouse Tmem106b protein, His-tagged | +Inquiry |
TMEM106B-3274H | Recombinant Human TMEM106B, GST-tagged | +Inquiry |
TMEM106B-4574R | Recombinant Rhesus Macaque TMEM106B Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM106B-33H | Recombinant Human TMEM106B Protein, GST-tagged | +Inquiry |
TMEM106B-1930C | Recombinant Chicken TMEM106B | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM106B-1016HCL | Recombinant Human TMEM106B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM106B Products
Required fields are marked with *
My Review for All TMEM106B Products
Required fields are marked with *