Recombinant Human TMEM123 protein, GST-tagged
Cat.No. : | TMEM123-301360H |
Product Overview : | Recombinant Human TMEM123 (27-146 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | His27-Ser146 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | HESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAAS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TMEM123 transmembrane protein 123 [ Homo sapiens ] |
Official Symbol | TMEM123 |
Synonyms | TMEM123; transmembrane protein 123; porimin; KCT3; PORIMIN; pro oncosis receptor inducing membrane injury gene; KCT-3; serine/threonine-rich receptor; pro oncosis receptor inducing membrane injury; pro-oncosis receptor inducing membrane injury; keratinocytes associated transmembrane protein 3; keratinocytes-associated transmembrane protein 3; PORMIN; |
Gene ID | 114908 |
mRNA Refseq | NM_052932 |
Protein Refseq | NP_443164 |
MIM | 606356 |
UniProt ID | Q8N131 |
◆ Recombinant Proteins | ||
TMEM123-1426C | Recombinant Chicken TMEM123 | +Inquiry |
TMEM123-4582R | Recombinant Rhesus Macaque TMEM123 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM123-5771R | Recombinant Rat TMEM123 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM123-16901M | Recombinant Mouse TMEM123 Protein | +Inquiry |
TMEM123-9284M | Recombinant Mouse TMEM123 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM123-1790HCL | Recombinant Human TMEM123 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM123 Products
Required fields are marked with *
My Review for All TMEM123 Products
Required fields are marked with *