Recombinant Human TMEM134 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TMEM134-6601H |
| Product Overview : | TMEM134 MS Standard C13 and N15-labeled recombinant protein (NP_079400) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TMEM134 (Transmembrane Protein 134) is a Protein Coding gene. Diseases associated with TMEM134 include Hepatitis E and Hypopyon. |
| Molecular Mass : | 21.4 kDa |
| AA Sequence : | MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TMEM134 transmembrane protein 134 [ Homo sapiens (human) ] |
| Official Symbol | TMEM134 |
| Synonyms | TMEM134; transmembrane protein 134; transmembrane protein 134 |
| Gene ID | 80194 |
| mRNA Refseq | NM_025124 |
| Protein Refseq | NP_079400 |
| UniProt ID | Q9H6X4 |
| ◆ Recombinant Proteins | ||
| TMEM134-289H | Recombinant Human TMEM134 Protein, MYC/DDK-tagged | +Inquiry |
| TMEM134-9295M | Recombinant Mouse TMEM134 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMEM134-6601H | Recombinant Human TMEM134 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TMEM134-10689Z | Recombinant Zebrafish TMEM134 | +Inquiry |
| Tmem134-6474M | Recombinant Mouse Tmem134 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM134-1004HCL | Recombinant Human TMEM134 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM134 Products
Required fields are marked with *
My Review for All TMEM134 Products
Required fields are marked with *
