Recombinant Human TMEM141 Protein (1-108 aa), GST-tagged

• Cat.No.: TMEM141-835H
• Product Overview: Recombinant Human TMEM141 Protein (1-108 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-108 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 38.9 kDa
• AA Sequence: MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: TMEM141 transmembrane protein 141 [ Homo sapiens ]
• Official Symbol: TMEM141
• Synonyms: TMEM141; transmembrane protein 141; MGC14141; RP11-216L13.7
• Gene ID: 85014
• mRNA Refseq: NM_032928
• Protein Refseq: NP_116317
• UniProt ID: Q96I45