Recombinant Human TMEM141 Protein (1-108 aa), GST-tagged
Cat.No. : | TMEM141-835H |
Product Overview : | Recombinant Human TMEM141 Protein (1-108 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-108 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 38.9 kDa |
AA Sequence : | MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TMEM141 transmembrane protein 141 [ Homo sapiens ] |
Official Symbol | TMEM141 |
Synonyms | TMEM141; transmembrane protein 141; MGC14141; RP11-216L13.7; |
Gene ID | 85014 |
mRNA Refseq | NM_032928 |
Protein Refseq | NP_116317 |
UniProt ID | Q96I45 |
◆ Recombinant Proteins | ||
RFL6717MF | Recombinant Full Length Mouse Transmembrane Protein 141(Tmem141) Protein, His-Tagged | +Inquiry |
TMEM141-4494Z | Recombinant Zebrafish TMEM141 | +Inquiry |
TMEM141-9300M | Recombinant Mouse TMEM141 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28074DF | Recombinant Full Length Danio Rerio Transmembrane Protein 141(Tmem141) Protein, His-Tagged | +Inquiry |
TMEM141-3258H | Recombinant Human TMEM141 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM141-1001HCL | Recombinant Human TMEM141 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM141 Products
Required fields are marked with *
My Review for All TMEM141 Products
Required fields are marked with *