Recombinant Human TMEM141 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TMEM141-3258H |
| Product Overview : | TMEM141 MS Standard C13 and N15-labeled recombinant protein (NP_116317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TMEM141 (Transmembrane Protein 141) is a Protein Coding gene. Diseases associated with TMEM141 include Intraneural Perineurioma. An important paralog of this gene is CCDC151. |
| Molecular Mass : | 11.9 kDa |
| AA Sequence : | MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TMEM141 transmembrane protein 141 [ Homo sapiens (human) ] |
| Official Symbol | TMEM141 |
| Synonyms | TMEM141; transmembrane protein 141; MGC14141; RP11-216L13.7; |
| Gene ID | 85014 |
| mRNA Refseq | NM_032928 |
| Protein Refseq | NP_116317 |
| UniProt ID | Q96I45 |
| ◆ Recombinant Proteins | ||
| RFL6717MF | Recombinant Full Length Mouse Transmembrane Protein 141(Tmem141) Protein, His-Tagged | +Inquiry |
| TMEM141-16920M | Recombinant Mouse TMEM141 Protein | +Inquiry |
| TMEM141-3258H | Recombinant Human TMEM141 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TMEM141-9300M | Recombinant Mouse TMEM141 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMEM141-291H | Recombinant Human TMEM141 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM141-1001HCL | Recombinant Human TMEM141 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM141 Products
Required fields are marked with *
My Review for All TMEM141 Products
Required fields are marked with *
