Recombinant Human TMEM173 protein, His-tagged

• Cat.No.: TMEM173-3282H
• Product Overview: Recombinant Human TMEM173(174-379aa) fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 174-379aa
• Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
• AA Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELL ENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSF SLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
• Purity: > 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).

Gene Information

• Gene Name: TMEM173 transmembrane protein 173 [ Homo sapiens ]
• Official Symbol: TMEM173
• Synonyms: TMEM173; transmembrane protein 173; FLJ38577; NET23; hMITA; hSTING; mediator of IRF3 activation; endoplasmic reticulum IFN stimulator; stimulator of interferon genes protein; mitochondrial mediator of IRF3 activation; endoplasmic reticulum interferon stimulator; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; ERIS; MITA; MPYS; STING
• Gene ID: 340061
• mRNA Refseq: NM_198282
• Protein Refseq: NP_938023
• MIM: 612374
• UniProt ID: Q86WV6
• Chromosome Location: 5q31.2
• Pathway: Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem
• Function: protein binding; protein homodimerization activity; protein kinase binding; protein kinase binding; transcription factor binding; ubiquitin protein ligase binding