Recombinant Human TMEM173 protein, His-tagged
Cat.No. : | TMEM173-3282H |
Product Overview : | Recombinant Human TMEM173(174-379aa) fused with His tag at N-terminal was expressed in E. coli. |
Availability | October 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 174-379aa |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
AA Sequence : | ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELL ENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSF SLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS |
Purity : | > 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | TMEM173 transmembrane protein 173 [ Homo sapiens ] |
Official Symbol | TMEM173 |
Synonyms | TMEM173; transmembrane protein 173; FLJ38577; NET23; hMITA; hSTING; mediator of IRF3 activation; endoplasmic reticulum IFN stimulator; stimulator of interferon genes protein; mitochondrial mediator of IRF3 activation; endoplasmic reticulum interferon stimulator; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; ERIS; MITA; MPYS; STING; |
Gene ID | 340061 |
mRNA Refseq | NM_198282 |
Protein Refseq | NP_938023 |
MIM | 612374 |
UniProt ID | Q86WV6 |
Chromosome Location | 5q31.2 |
Pathway | Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem; |
Function | protein binding; protein homodimerization activity; protein kinase binding; protein kinase binding; transcription factor binding; ubiquitin protein ligase binding; |
◆ Recombinant Proteins | ||
TMEM173-3282H | Recombinant Human TMEM173 protein, His-tagged | +Inquiry |
TMEM173-8322Z | Recombinant Zebrafish TMEM173 | +Inquiry |
Tmem173-1438R | Recombinant Rat Tmem173 protein, His & T7-tagged | +Inquiry |
RFL28001BF | Recombinant Full Length Bovine Transmembrane Protein 173(Tmem173) Protein, His-Tagged | +Inquiry |
TMEM173-284H | Recombinant Human TMEM173 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM173-988HCL | Recombinant Human TMEM173 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM173 Products
Required fields are marked with *
My Review for All TMEM173 Products
Required fields are marked with *