Recombinant Human TMEM187 Protein, GST-tagged

Cat.No. : TMEM187-2185H
Product Overview : Human CXorf12 full-length ORF ( AAH08203, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene consists of two exons and encodes a multi-pass membrane protein. An alternatively spliced transcript variant encoding the same protein has been found, but its biological validity is not determined. [provided by RefSeq, May 2010]
Molecular Mass : 54.45 kDa
AA Sequence : MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TMEM187 transmembrane protein 187 [ Homo sapiens ]
Official Symbol TMEM187
Synonyms TMEM187; transmembrane protein 187; chromosome X open reading frame 12 , CXorf12; DXS9878E; ITBA1; CXorf12; FLJ95849;
Gene ID 8269
mRNA Refseq NM_003492
Protein Refseq NP_003483
MIM 300059
UniProt ID Q14656

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM187 Products

Required fields are marked with *

My Review for All TMEM187 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon