Recombinant Human TMEM189-UBE2V1 Protein, GST-tagged

Cat.No. : TMEM189-UBE2V1-4789H
Product Overview : Human Kua-UEV partial ORF ( NP_954673, 94 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 94-164 a.a.
Description : The TMEM189-UEV mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this co-transcribed mRNA and the function of its protein product has not yet been determined. [provided by RefSeq
Molecular Mass : 33.55 kDa
AA Sequence : VHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TMEM189-UBE2V1 TMEM189-UBE2V1 readthrough [ Homo sapiens (human) ]
Official Symbol TMEM189-UBE2V1
Synonyms TMEM189-UBE2V1; TMEM189-UBE2V1 readthrough; CROC1B; CROC-1B; KUA-UEV; TMEM189-UBE2V1 fusion protein; TMEM189-UBE2V1 readthrough transcript; transmembrane protein 189-ubiquitin-conjugating enzyme E2 variant 1 read-through
Gene ID https://www.ncbi.nlm.nih.gov/gene/?term=387522
mRNA Refseq NM_199203
Protein Refseq NP_954673
UniProt ID U39361

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM189-UBE2V1 Products

Required fields are marked with *

My Review for All TMEM189-UBE2V1 Products

Required fields are marked with *

0
cart-icon