Recombinant Human TMEM189-UBE2V1 Protein, GST-tagged
Cat.No. : | TMEM189-UBE2V1-4789H |
Product Overview : | Human Kua-UEV partial ORF ( NP_954673, 94 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 94-164 a.a. |
Description : | The TMEM189-UEV mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this co-transcribed mRNA and the function of its protein product has not yet been determined. [provided by RefSeq |
Molecular Mass : | 33.55 kDa |
AA Sequence : | VHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMEM189-UBE2V1 TMEM189-UBE2V1 readthrough [ Homo sapiens (human) ] |
Official Symbol | TMEM189-UBE2V1 |
Synonyms | TMEM189-UBE2V1; TMEM189-UBE2V1 readthrough; CROC1B; CROC-1B; KUA-UEV; TMEM189-UBE2V1 fusion protein; TMEM189-UBE2V1 readthrough transcript; transmembrane protein 189-ubiquitin-conjugating enzyme E2 variant 1 read-through |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=387522 |
mRNA Refseq | NM_199203 |
Protein Refseq | NP_954673 |
UniProt ID | U39361 |
◆ Recombinant Proteins | ||
TMEM189-UBE2V1-010H | Recombinant Human TMEM189-UBE2V1 protein, HIS-tagged | +Inquiry |
TMEM189-UBE2V1-4203H | Recombinant Human TMEM189-UBE2V1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM189-UBE2V1-4789H | Recombinant Human TMEM189-UBE2V1 Protein, GST-tagged | +Inquiry |
TMEM189-UBE2V1-1784H | Recombinant Human TMEM189-UBE2V1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM189-UBE2V1 Products
Required fields are marked with *
My Review for All TMEM189-UBE2V1 Products
Required fields are marked with *