Recombinant Human TMEM208 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM208-4941H
• Product Overview: TMEM208 MS Standard C13 and N15-labeled recombinant protein (NP_054906) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 19.6 kDa
• AA Sequence: MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM208 transmembrane protein 208 [ Homo sapiens (human) ]
• Official Symbol: TMEM208
• Synonyms: TMEM208; transmembrane protein 208; hSND2; HSPC171; transmembrane protein 208; SRP-independent targeting 2 homolog
• Gene ID: 29100
• mRNA Refseq: NM_014187
• Protein Refseq: NP_054906
• UniProt ID: Q9BTX3