Recombinant Human TMEM219 protein, His-tagged
Cat.No. : | TMEM219-6874H |
Product Overview : | Recombinant Human TMEM219 protein(Q86XT9)(39-204aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 39-204a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR |
◆ Recombinant Proteins | ||
TMEM219-854H | Recombinant Human TMEM219 protein, hFc-tagged | +Inquiry |
TMEM219-4589H | Recombinant Human TMEM219 protein, His&Myc-tagged | +Inquiry |
TMEM219-16999M | Recombinant Mouse TMEM219 Protein | +Inquiry |
TMEM219-4623R | Recombinant Rhesus Macaque TMEM219 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM219-9361M | Recombinant Mouse TMEM219 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM219 Products
Required fields are marked with *
My Review for All TMEM219 Products
Required fields are marked with *