Recombinant Human TMEM230 protein, His-tagged
Cat.No. : | TMEM230-178H |
Product Overview : | Recombinant Human TMEM230 protein(NP_001009923)(1-120 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-120 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TMEM230 transmembrane protein 230 [ Homo sapiens (human) ] |
Official Symbol | TMEM230 |
Synonyms | HSPC274; C20orf30; dJ1116H23.2.1 |
Gene ID | 29058 |
mRNA Refseq | NM_001009923.2 |
Protein Refseq | NP_001009923.1 |
MIM | 617019 |
UniProt ID | Q96A57 |
◆ Cell & Tissue Lysates | ||
TMEM230-8115HCL | Recombinant Human C20orf30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM230 Products
Required fields are marked with *
My Review for All TMEM230 Products
Required fields are marked with *
0
Inquiry Basket