Recombinant Human TMEM230 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM230-1659H
Product Overview : C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009925) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease.
Molecular Mass : 13.2 kDa
AA Sequence : MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM230 transmembrane protein 230 [ Homo sapiens (human) ]
Official Symbol TMEM230
Synonyms TMEM230; transmembrane protein 230; HSPC274; C20orf30; dJ1116H23.2.1; transmembrane protein 230; UPF0414 transmembrane protein C20orf30
Gene ID 29058
mRNA Refseq NM_001009925
Protein Refseq NP_001009925
MIM 617019
UniProt ID Q96A57

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM230 Products

Required fields are marked with *

My Review for All TMEM230 Products

Required fields are marked with *

0
cart-icon
0
compare icon