Recombinant Full Length Chicken Upf0414 Transmembrane Protein C20Orf30 Homolog(Rcjmb04_6C24) Protein, His-Tagged
| Cat.No. : | RFL21444GF |
| Product Overview : | Recombinant Full Length Chicken UPF0414 transmembrane protein C20orf30 homolog(RCJMB04_6c24) Protein (Q5ZLH4) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-120) |
| Form : | Lyophilized powder |
| AA Sequence : | MMPSRTNLSAGIPSSKVKYSKLASTDDGYIDLQFKKSPPKIPYKAIALAVVLFMIGTFLI IIGALLLAGYISKGGTDRAIPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | TMEM230 |
| Synonyms | TMEM230; RCJMB04_6c24; Transmembrane protein 230 |
| UniProt ID | Q5ZLH4 |
| ◆ Recombinant Proteins | ||
| TMEM230-6156R | Recombinant Rat TMEM230 Protein | +Inquiry |
| TMEM230-1659H | Recombinant Human TMEM230 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL28363HF | Recombinant Full Length Human Upf0414 Transmembrane Protein C20Orf30(C20Orf30) Protein, His-Tagged | +Inquiry |
| TMEM230-481H | Recombinant Human TMEM230 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TMEM230-1786C | Recombinant Chicken TMEM230 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM230-8115HCL | Recombinant Human C20orf30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM230 Products
Required fields are marked with *
My Review for All TMEM230 Products
Required fields are marked with *
