Recombinant Human TMEM242 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMEM242-2217H |
Product Overview : | C6orf35 MS Standard C13 and N15-labeled recombinant protein (NP_060922) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TMEM242 (Transmembrane Protein 242) is a Protein Coding gene. Diseases associated with TMEM242 include Chromosome 3Pter-P25 Deletion Syndrome and Familial Isolated Trichomegaly. |
Molecular Mass : | 14.8 kDa |
AA Sequence : | METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMEM242 transmembrane protein 242 [ Homo sapiens (human) ] |
Official Symbol | TMEM242 |
Synonyms | TMEM242; transmembrane protein 242; BM033; C6orf35; transmembrane protein 242; UPF0463 transmembrane protein C6orf35 |
Gene ID | 729515 |
mRNA Refseq | NM_018452 |
Protein Refseq | NP_060922 |
UniProt ID | Q9NWH2 |
◆ Recombinant Proteins | ||
TMEM242-1379H | Recombinant Human TMEM242 | +Inquiry |
RFL14329MF | Recombinant Full Length Mouse Transmembrane Protein 242(Tmem242) Protein, His-Tagged | +Inquiry |
TMEM242-9380M | Recombinant Mouse TMEM242 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM242-17019M | Recombinant Mouse TMEM242 Protein | +Inquiry |
RFL17213DF | Recombinant Full Length Danio Rerio Transmembrane Protein 242(Tmem242) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM242-7982HCL | Recombinant Human C6orf35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM242 Products
Required fields are marked with *
My Review for All TMEM242 Products
Required fields are marked with *